DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP007141

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_565054.3 Gene:AgaP_AGAP007141 / 3290313 VectorBaseID:AGAP007141 Length:254 Species:Anopheles gambiae


Alignment Length:253 Identity:74/253 - (29%)
Similarity:111/253 - (43%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMM--KCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQA 103
            ||:.|..|...:.|:.|.:  :|:.  .|||::|...::||||||...:.....|.:|...:|..
Mosquito    30 RVVGGTDAPPGAAPYQVSL--QGLFGHSCGGAIIDRDWILTAAHCVQTSVKFTKVLVGTNLLNAG 92

  Fly   104 VDCSSYGCIPRPREINVTRTYVPSHYTN--FRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSS 166
                       .:...|.:.||.|.|.|  |. |||||::|::.:||.|.::.|       .:|.
Mosquito    93 -----------GQRYAVEKFYVHSRYNNPVFH-NDIALVKLKSMIQYDDLVQPI-------AYSE 138

  Fly   167 NILKNLVKFNTTGWGRTESRINSP-VLQQASLTHHHLSYCAQVFG--KQLDKSHICVASSTG-ST 227
            ..:........|||||.......| .||...||:.....|.::.|  :.:|..|:|..:..| ..
Mosquito   139 REIPENATLTLTGWGRLSGTGAMPNKLQTIDLTYVPYEECKRLHGNSENVDIGHVCTLTKKGEGA 203

  Fly   228 CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG-PTVYTNVIHFANWIELHTKKN 284
            |.|||||||....:        |.|||::|.....| |..|..|.::.:||......|
Mosquito   204 CNGDSGGPLVYEGK--------LVGVVNFGVPCALGYPDAYARVSYYHDWIRTTIANN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/244 (29%)
Tryp_SPc 42..280 CDD:238113 72/246 (29%)
AgaP_AGAP007141XP_565054.3 Tryp_SPc 30..246 CDD:214473 71/244 (29%)
Tryp_SPc 31..249 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.