DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:279 Identity:78/279 - (27%)
Similarity:129/279 - (46%) Gaps:54/279 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII---ERGMMKCGGSLITPRYVLTAAHCKSET 87
            |.|:....|::....||:||:.|.....|:.|.::   ..|...||||::|..::||||||.|.|
Mosquito    41 LPPELQVYRNDTSTDRVVNGQEALPGQFPYQVALLLNFPDGTALCGGSVLTRNFILTAAHCVSAT 105

  Fly    88 KSQLT----VRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV---PSHYTNFRKNDIALLRLETT 145
            .:.|.    ..:|.:: ..|::.|.       :.|..|.|.:   |.:.....:||:||:.|.:.
Mosquito   106 STTLVSGGIAIMGAHN-RTAMELSQ-------QRIRFTSTGIRRHPEYDDTSLRNDVALILLNSP 162

  Fly   146 VQYGDNIRSICLLMGDYTWSSNILKNLVKFNTT--GWGRTESR----------INSPVLQQASLT 198
            :.:...::.|.|.....|      :....|..|  |:||:...          .::|::.:|.  
Mosquito   163 MTFTSRVKPISLPARTDT------RQFEGFTGTVSGFGRSSDASPYPSSILRFTSNPIMSKAE-- 219

  Fly   199 HHHLSYCAQVFGKQLDKS-HICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH- 260
                  |...:|..|.:| ::|:..:.| |:|.||||||||  |..|.   |:..|.||:|:.: 
Mosquito   220 ------CIVSWGFALAQSQNVCLKPTGGRSSCNGDSGGPLT--VNSGG---VLQIGTVSFGSSYG 273

  Fly   261 CFG--PTVYTNVIHFANWI 277
            |..  |:||..|.:|.:||
Mosquito   274 CASGWPSVYARVSYFLSWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/262 (28%)
Tryp_SPc 42..280 CDD:238113 74/263 (28%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 73/262 (28%)
Tryp_SPc 57..295 CDD:238113 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.