DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP005304

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_560320.2 Gene:AgaP_AGAP005304 / 3289940 VectorBaseID:AGAP005304 Length:501 Species:Anopheles gambiae


Alignment Length:267 Identity:61/267 - (22%)
Similarity:95/267 - (35%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GKPADLFSNPWMVIIIERGMMKCGG----SLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD 105
            |:.:..:..||...:....:...||    :||...|.:..|.|...:.:|..:..|.:.....::
Mosquito   239 GESSPSYLTPWTGGVYYDKLEFEGGTGLVTLINEWYAVGPASCFDNSSAQFIIVFGFFGKAIEIE 303

  Fly   106 CSSYG----CIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYG-DNIRSICLLMGDYTWS 165
            |....    |...|:.:.|.:.:....|...|.:||||::|.|.|... .|::.|||.:.|...|
Mosquito   304 CDMTNNTELCNVPPQSVTVQKVFNHPLYNGTRNHDIALVKLATRVDTSRPNVKPICLPITDAIRS 368

  Fly   166 ---SNILKNLVKFNTT--------------GWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQL 213
               ||::.....|..|              .|...:.|.                        .:
Mosquito   369 YDVSNLVMRKSSFELTKVDDRYVDTEECQKRWQGLKVRF------------------------AV 409

  Fly   214 DKSHICVAS--STGSTC----QGDSGGPLTARVRIGSERRVILFGVVSYGAVHC--FGPTVYTNV 270
            |:|..||..  :...||    .|||   |.:...:.|..|..|.|.|.....||  :.|.||||.
Mosquito   410 DESKHCVIQQRTMEETCITINAGDS---LQSLQTMASGDRHFLRGFVIARPSHCSIYYPVVYTNT 471

  Fly   271 IHFANWI 277
            ..:.:||
Mosquito   472 DTYLDWI 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 59/265 (22%)
Tryp_SPc 42..280 CDD:238113 61/267 (23%)
AgaP_AGAP005304XP_560320.2 Tryp_SPc <12..>76 CDD:304450
Tryp_SPc 248..481 CDD:304450 60/258 (23%)
Tryp_SPc 248..478 CDD:214473 58/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.