DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG4653

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:286 Identity:74/286 - (25%)
Similarity:118/286 - (41%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSL 71
            :||||:.:|.|.|.....|                     ||::.|.|..:.:...|:..|||:|
  Fly    11 RLLLLVVIVTLGVVQSSRL---------------------PAEVGSQPHSISLRRNGVHVCGGAL 54

  Fly    72 ITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPR---PREINVTRTYVPSHYTN-- 131
            |..:::||||||.|....|.:.....|:|.       .|.|.|   .:.:.:::..:.::|::  
  Fly    55 IREKWILTAAHCVSLGGGQQSYPAKSYNVR-------VGSIQRLTGGQLVPLSKIIIHTNYSSSD 112

  Fly   132 -FRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRIN---SPVL 192
             ...||:|||.|||:|....|...|.|........|.|:       .:|||  .|:::   |.||
  Fly   113 AVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQII-------FSGWG--SSQVDGSLSHVL 168

  Fly   193 QQASLTHHHLSYC-AQVFGKQLDKSHIC---VASSTGSTCQGDSGGPLTARVRIGSERRVILFGV 253
            |.|:......|.| .:::.:|.|.  :|   |.......|.||:|.|.:...:        |.|:
  Fly   169 QVATRQSLSASDCQTELYLQQEDL--LCLSPVDEDFAGLCSGDAGAPASYNNQ--------LVGI 223

  Fly   254 VSYGAVHCFG--PTVYTNVIHFANWI 277
            .::....|..  |..|.:|.....||
  Fly   224 AAFFVSGCGSEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 64/250 (26%)
Tryp_SPc 42..280 CDD:238113 66/251 (26%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/246 (27%)
Tryp_SPc 30..249 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.