DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and HPN

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:255 Identity:79/255 - (30%)
Similarity:106/255 - (41%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQ 102
            |::.|:...|...||.|.:...|...|||||::..:|||||||   ::...|:..|..|      
Human   162 RIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAG------ 220

  Fly   103 AVDCSSYGCIPRPREINVTRTYVPSHYTNFR-------KNDIALLRLETTVQYGDNIRSICL-LM 159
            ||..:|    |...::.|........|..||       .|||||:.|.:.:...:.|:.:|| ..
Human   221 AVAQAS----PHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAA 281

  Fly   160 GDYTWSSNILKNLVKFNTTGWGRTE-SRINSPVLQQASLTHHHLSYC--AQVFGKQLDKSHICVA 221
            |.......|.      ..||||.|: ....:.|||:|.:.......|  |..:|.|:.....|..
Human   282 GQALVDGKIC------TVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAG 340

  Fly   222 SSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVIHFANWI 277
            ...|  ..||||||||......|....|..|.|:||:|......  |.|||.|..|..||
Human   341 YPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/253 (30%)
Tryp_SPc 42..280 CDD:238113 78/254 (31%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275
Tryp_SPc 163..400 CDD:238113 76/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.