DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG32376

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:246 Identity:67/246 - (27%)
Similarity:116/246 - (47%) Gaps:33/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD 105
            |::|||.......|:...:...|...||..:|...::|||.||......:.|||:|.....:.  
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVRVGSDQQRRG-- 127

  Fly   106 CSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILK 170
                |.:...::|.....|  :.||  .::|:|:::|::.|.:|..:|.:.|.      |:...|
  Fly   128 ----GQLRHVKKIVALAAY--NDYT--MRHDLAMMKLKSPVYFGKCVRPVKLP------STKTTK 178

  Fly   171 NLVKFNTTGWGRTESRINS--PVLQQASLTHHHLSYCAQVF---GKQLDKSHICVASSTGSTCQG 230
            ...||..:|||.|.:...:  ..|::..:.:...|.|.:::   |.::.|..||.:.:...:|.|
  Fly   179 FPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSG 243

  Fly   231 DSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIE 278
            |||||||:        |.:|:|:||:| :.|..   |.||.|...:..||:
  Fly   244 DSGGPLTS--------RGVLYGIVSWG-IGCANKNYPGVYVNCKRYVPWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 65/243 (27%)
Tryp_SPc 42..280 CDD:238113 66/245 (27%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 65/243 (27%)
Tryp_SPc 66..287 CDD:238113 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.