DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG14780

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:109/268 - (40%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK----------CGGSLITPRYVLTAAHCKSETKSQLTVRL 95
            |:|||..|.......:|.|   .:::          |||:||.||.|||||||....:.:...|.
  Fly    32 RIINGSVAKADETRHLVSI---RLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYNNQRKRFRRA 93

  Fly    96 GDYDVNQAVDCSSYGCIPRPREINVT-------RTYVPSHYTNFRKNDIALLRLET--TVQYGDN 151
            .::.|       ..|.:.|....|.|       ..|:.:...:..::|:.:|.|.|  .:..|..
  Fly    94 SEFVV-------VLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGG 151

  Fly   152 IR---SICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQL 213
            :.   :...|.|..|....:.:      ..||||||....|.:|..|:::......|..::...|
  Fly   152 VHLTVAPIQLAGQITPPGKLCQ------VAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGL 210

  Fly   214 DKSHICVASSTGST--CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG------PTVYTNV 270
            ....:|.....|.|  |||||||||....|        |.||||:|    :|      |.||.:|
  Fly   211 LPGMMCAGRLQGGTDSCQGDSGGPLVHEGR--------LVGVVSWG----YGCAEPGLPGVYVDV 263

  Fly   271 IHFANWIE 278
            .::..|||
  Fly   264 EYYRQWIE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/265 (27%)
Tryp_SPc 42..280 CDD:238113 73/267 (27%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 71/265 (27%)
Tryp_SPc 33..271 CDD:238113 71/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.