DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and HGF

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:254 Identity:73/254 - (28%)
Similarity:105/254 - (41%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAV 104
            ||:||.|... :..|||.:..|....||||||...:||||..| .|.........||.:||:...
Human   494 RVVNGIPTRT-NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRG 557

  Fly   105 D--CSSYGCIPRPREINVTR-TYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSS 166
            |  |.        :.:||:: .|.|      ..:|:.|::|.......|.:.:|.|.....|   
Human   558 DEKCK--------QVLNVSQLVYGP------EGSDLVLMKLARPAVLDDFVSTIDLPNYGCT--- 605

  Fly   167 NILKNLVKFNTTGWGRTESRINSPVLQQASL--------THHHLSYCAQVFGK-QLDKSHICV-A 221
              :......:..|||.|.......:|:.|.|        :.||.       || .|::|.||. |
Human   606 --IPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHR-------GKVTLNESEICAGA 661

  Fly   222 SSTGS-TCQGDSGGPLTARVRIGSERRVILFGVV--SYGAVHCFGPTVYTNVIHFANWI 277
            ...|| .|:||.||||.....   :.|::| ||:  ..|......|.::..|.::|.||
Human   662 EKIGSGPCEGDYGGPLVCEQH---KMRMVL-GVIVPGRGCAIPNRPGIFVRVAYYAKWI 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/252 (28%)
Tryp_SPc 42..280 CDD:238113 72/253 (28%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056
Tryp_SPc 494..716 CDD:214473 71/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.