DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Pik3ip1

DIOPT Version :10

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001382087.1 Gene:Pik3ip1 / 305472 RGDID:1311203 Length:267 Species:Rattus norvegicus


Alignment Length:54 Identity:15/54 - (27%)
Similarity:19/54 - (35%) Gaps:7/54 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGM 64
            |..|.:|..||....|      |:..||.:........|. ..||..|..|.|:
  Rat    44 LRCLNWLAAQGSGESL------AQPSPGNHNYCRNPDQDP-RGPWCYISSETGV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 6/23 (26%)
Pik3ip1NP_001382087.1 KR 23..103 CDD:214527 15/54 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..122 15/54 (28%)

Return to query results.
Submit another query.