DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss32

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:280 Identity:82/280 - (29%)
Similarity:118/280 - (42%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETK-- 88
            ||..|...|:..   |:::|:.|.|...||.|.:.|.|:..||||||:..:|||||||.::.:  
  Rat    41 LDSVCGRPRASG---RIVSGQNAQLGQWPWQVSVREDGVHVCGGSLISEDWVLTAAHCFNQDQHL 102

  Fly    89 SQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV--PSHYT-NFRKNDIALLRLETTVQYGD 150
            |..||.||        ..|||.....|||:.....|:  ||:.. .....|||||:|.:.:.:.|
  Rat   103 SAYTVLLG--------TISSYPEDNEPRELRAVAQYIKYPSYSAEEHSSGDIALLQLASPISFND 159

  Fly   151 NIRSICLLM-------GDYTWSSNILKNLVKFNTTGWGR-----------TESRINSPVLQQASL 197
            .:..:||..       |...|            .||||.           |...:..|::...:.
  Rat   160 YMLPVCLPKPGDPLDPGTMCW------------VTGWGNIATNQPLPPPFTLQELQVPLIDAKTC 212

  Fly   198 THHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260
            ..::.........:.:.:..:|.....|  ..|.|||||||...|    ....|..||||:|:..
  Rat   213 NTYYQENSVPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDV----NDVWIQAGVVSWGSDC 273

  Fly   261 CFG--PTVYTNVIHFANWIE 278
            ...  |.|||||..:.:||:
  Rat   274 ALSNRPGVYTNVSVYISWIQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/262 (29%)
Tryp_SPc 42..280 CDD:238113 77/264 (29%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 76/262 (29%)
Tryp_SPc 54..295 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.