DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and HABP2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:272 Identity:83/272 - (30%)
Similarity:121/272 - (44%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TARSEPGLYRVINGKPADLFSNPW---------MVIIIERGMMKCGGSLITPRYVLTAAHCKSET 87
            |..:|..:.|:..|..:....:||         :.|.:.:|.. |||:||.|.:|||||||....
Human   304 TEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHF-CGGALIHPCWVLTAAHCTDIK 367

  Fly    88 KSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYT---NFRKNDIALLRLETTVQY- 148
            ...|.|.|||.|:.:...        ..:...|.:.:..|||.   ....||||||:|:....: 
Human   368 TRHLKVVLGDQDLKKEEF--------HEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHC 424

  Fly   149 ---GDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQA--SLTHHHLSYCAQV 208
               ...::::||..|.:...|       :.:.:|||.||:...|..|..|  .|..:.|....|:
Human   425 ALESKYVKTVCLPDGSFPSGS-------ECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSRQL 482

  Fly   209 FGKQLDKSHICVAS--STG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPTVYTNV 270
            :...:|.|.||..:  ..| .|||||||||||..    .:....::|:||:|......|.|||.|
Human   483 YDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCE----KDGTYYVYGIVSWGLECGKRPGVYTQV 543

  Fly   271 IHFANWIELHTK 282
            ..|.|||:...|
Human   544 TKFLNWIKATIK 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/256 (30%)
Tryp_SPc 42..280 CDD:238113 79/258 (31%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 79/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.