DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss42

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:282 Identity:83/282 - (29%)
Similarity:128/282 - (45%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTA 80
            |..|.|||               |.:::.|..|:....||.|.:..|.|..|||||:..::||||
  Rat    73 FSIVCGQP---------------LMKIMGGVDAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTA 122

  Fly    81 AHCKSETKSQLTVRLGD---YDVNQAVDCSSYGCIPRPREINVTRTYVPSHY--TNFRKNDIALL 140
            ||| ..::.|..|::||   |..|.::      .||      :...:|...:  |...:||||||
  Rat   123 AHC-IHSRVQYNVKMGDRSVYRQNTSL------VIP------IQNIFVHPKFSTTTVVQNDIALL 174

  Fly   141 RLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTE---SRINSPVLQQASLTHHHL 202
            :|:..|.:..:|..||:..|.:.     :|...|...||||:.:   .:|.:.:||:...:....
  Rat   175 KLQQPVNFTSSIHPICVPTGTFH-----VKAGTKCWVTGWGKPDPGAPQIPTEILQEVDQSIILY 234

  Fly   203 SYCAQVFGKQ-------LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAV 259
            ..|.::..|.       :.:..:|.....| ..|||||||||:...    :.|.:..||||:| :
  Rat   235 EECNEMLKKMASTSVDLVKRGMVCAYKEGGKDACQGDSGGPLSCEF----DNRWVQIGVVSWG-I 294

  Fly   260 HCFG----PTVYTNVIHFANWI 277
            .| |    |.|||:|..:..|:
  Rat   295 GC-GRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/255 (30%)
Tryp_SPc 42..280 CDD:238113 77/256 (30%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 76/254 (30%)
Tryp_SPc 84..315 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.