DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and GZMA

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:278 Identity:70/278 - (25%)
Similarity:114/278 - (41%) Gaps:82/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVII-IERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAV 104
            ::|.|......|.|:||:: ::|..: |.|:||...:|||||||....:||  |.||.:.:.:..
Human    28 KIIGGNEVTPHSRPYMVLLSLDRKTI-CAGALIAKDWVLTAAHCNLNKRSQ--VILGAHSITREE 89

  Fly   105 DCSSYGCIPRPREINVTRTY-VPSHYTNFRKNDIALLRL--------ETTVQY----GDNIR--S 154
                    |..:.:.|.:.: .|.:....|:.|:.||:|        ..|:.:    ||:::  :
Human    90 --------PTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGT 146

  Fly   155 ICLLMGDYTWSSNILKNLVKFNTTGWGRTESRIN-SPVLQQASLTHHHLSYCAQVFGKQLDKSH- 217
            :|                   ...|||||.:..: |..|::.::|......|.       |::| 
Human   147 MC-------------------QVAGWGRTHNSASWSDTLREVNITIIDRKVCN-------DRNHY 185

  Fly   218 ----------ICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH-C---FGPTV 266
                      :|..|..|  .:|.||||.||..        ..:..||.|:|..: |   .||.|
Human   186 NFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLC--------EGVFRGVTSFGLENKCGDPRGPGV 242

  Fly   267 Y--TNVIHFANWIELHTK 282
            |  .:..|. |||.:..|
Human   243 YILLSKKHL-NWIIMTIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/271 (25%)
Tryp_SPc 42..280 CDD:238113 69/273 (25%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.