DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Habp2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001001505.2 Gene:Habp2 / 292126 RGDID:1302979 Length:558 Species:Rattus norvegicus


Alignment Length:281 Identity:83/281 - (29%)
Similarity:119/281 - (42%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TARSEPGLYRVINGKPADLFSNPWMVII-----IERGMMK---CGGSLITPRYVLTAAHCKSETK 88
            |..:|..:.|:..|..:....:||.|.:     :...|.:   ||||||.|.:|||||||...:.
  Rat   302 TEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGSLIHPCWVLTAAHCTDMST 366

  Fly    89 SQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFR-----------------KND 136
            ..|.|.|||.|:.:                      ..||...||                 .||
  Rat   367 KHLKVVLGDQDLKK----------------------TESHEQTFRVEKILKYSQYNERDEIPHND 409

  Fly   137 IALLRLETTVQY----GDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQA-- 195
            ||||:|:....:    ...::::||       .|:...:..:.:.:|||.||:...|..|..|  
  Rat   410 IALLKLKPVGGHCALESKYVKTVCL-------PSDPFPSGTECHISGWGVTETGEGSRQLLDAKV 467

  Fly   196 SLTHHHLSYCAQVFGKQLDKSHICVAS--STGS-TCQGDSGGPLTARVRIGSERRVILFGVVSYG 257
            .|..:.|....|::...:|.|.||..:  ..|| |||||||||||..    .:....::|:||:|
  Rat   468 KLIANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCE----KDGTYYVYGIVSWG 528

  Fly   258 AVHCFGPTVYTNVIHFANWIE 278
            ......|.|||.|..|.|||:
  Rat   529 QECGKKPGVYTQVTKFLNWIK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/269 (29%)
Tryp_SPc 42..280 CDD:238113 80/271 (30%)
Habp2NP_001001505.2 EGF_CA 71..107 CDD:238011
KR 191..275 CDD:238056
Tryp_SPc 312..551 CDD:238113 80/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.