DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Gzmk

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:281 Identity:82/281 - (29%)
Similarity:126/281 - (44%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYV 77
            ||||| |.|         :...||.....:|.|:.....|.|:|..|..||...|||.||.|::|
  Rat     7 ALVFL-VAG---------IYMSSESFHTEIIGGREVQPHSRPFMASIQYRGKHICGGVLIHPQWV 61

  Fly    78 LTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK--NDIALL 140
            ||||||.|...|. ||.||.:.:::..        |..:...: :.::|  ::.|:.  |||.|:
  Rat    62 LTAAHCYSRGHSP-TVVLGAHSLSKNE--------PMKQTFEI-KEFIP--FSGFKSGTNDIMLI 114

  Fly   141 RLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRI--NSPVLQQASLTHHHLS 203
            :|.|..:...:::.:.|.      |.|.:::..|...||||.|:..:  .|..||:.::|.....
  Rat   115 KLRTAAELNKHVQLLHLR------SKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRK 173

  Fly   204 YC-AQVFGKQ---LDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF 262
            .| :|.:...   :.|..||.....|  .:|:|||||||..:.         :|..:..|...| 
  Rat   174 RCNSQSYYNHKPVITKDMICAGDRRGEKDSCKGDSGGPLICKG---------VFHALVSGGYKC- 228

  Fly   263 G----PTVYTNVI-HFANWIE 278
            |    |.|||.:. .:..||:
  Rat   229 GISNKPGVYTLLTKKYQTWIK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/250 (28%)
Tryp_SPc 42..280 CDD:238113 73/252 (29%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 71/250 (28%)
Tryp_SPc 26..251 CDD:238113 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.