DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and F11

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:275 Identity:91/275 - (33%)
Similarity:123/275 - (44%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQ 90
            :|..| |.:..|   ||..|..:.....||.|.:.......||||:|..|::||||||.|.|::.
  Rat   376 MDNVC-TTKIRP---RVFGGAASVHGEWPWQVTLHTTQGHLCGGSIIGNRWILTAAHCFSGTETP 436

  Fly    91 LTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTY-------VPSHYTNFRKN-DIALLRLETTVQ 147
            .|:|:             ||.|....|||...|:       :...||:.... |||||:||..:.
  Rat   437 KTLRV-------------YGGIVNQSEINEDTTFFRVQEMIIHDQYTSAESGFDIALLKLEPAMN 488

  Fly   148 YGDNIRSICL-LMGDYTWSSNILKNLVKFN--TTGWGRTESR--INSPVLQQASLTHHHLSYCAQ 207
            |.|..|.||| ..||        :|:|...  .||||.|:||  :.| .||:|.:.......|..
  Rat   489 YTDFQRPICLPSKGD--------RNVVHTECWVTGWGYTKSRDEVQS-TLQKAKVPLVSNEECQT 544

  Fly   208 VFGK-QLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRV-ILFGVVSYGAVHCFG----- 263
            .:.| ::....||.....|  .||:|||||||:.:     ...| .|.|:.|:|.    |     
  Rat   545 RYRKHKITNKVICAGYKEGGKDTCKGDSGGPLSCK-----HNGVWHLVGITSWGE----GCGQKE 600

  Fly   264 -PTVYTNVIHFANWI 277
             |.|||||..:.:||
  Rat   601 RPGVYTNVAKYVDWI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 85/258 (33%)
Tryp_SPc 42..280 CDD:238113 86/259 (33%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519
Tryp_SPc 387..615 CDD:214473 85/258 (33%)
Tryp_SPc 388..615 CDD:238113 84/257 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.