DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss38

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:293 Identity:77/293 - (26%)
Similarity:119/293 - (40%) Gaps:79/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQCVTARSEPGLYRVIN---GKPA--------DLFSN---PWMVIIIERGMMKCGGSLITPRYVL 78
            |..:....||.|:..::   |:||        :|..:   ||.|.|...|...||||::...:||
  Rat    86 PPLLWCGREPSLHLFLSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVL 150

  Fly    79 TAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTN-FRKN------- 135
            |||||.:..|     ||..:|:                .:.:|...|.:.:|. |..|       
  Rat   151 TAAHCFAREK-----RLQTFDM----------------YVGITNLEVANKHTQWFEINQVIIHPT 194

  Fly   136 ---------DIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPV 191
                     |:||::.::.:.:.|.:..|||.      |||:..:.:...|||||..     ||.
  Rat   195 FEMFHPVGGDVALVQSKSAIVFSDYVLPICLP------SSNLNLSDLSCWTTGWGMV-----SPQ 248

  Fly   192 ------LQQASLTHHHLSYCAQVFG--KQLDKSHICVA--SSTGSTCQGDSGGPLTARVRIGSER 246
                  |.:|.|.......|..::|  ..|....:|..  .:..:.|:||||.||..:|    .:
  Rat   249 GETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNMKNVCEGDSGSPLVCKV----NQ 309

  Fly   247 RVILFGVVSY--GAVHCFGPTVYTNVIHFANWI 277
            ..:..|:||:  |......|.|:.||.:|.|||
  Rat   310 TWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWI 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/278 (26%)
Tryp_SPc 42..280 CDD:238113 73/279 (26%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 70/263 (27%)
Tryp_SPc 116..342 CDD:214473 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.