DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and LOC286960

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:258 Identity:65/258 - (25%)
Similarity:113/258 - (43%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVN---- 101
            :::.|........|:.|.:.:....:||||||:.::||:||||   .|.:|.||||:::::    
  Rat    23 KIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC---YKRKLQVRLGEHNIHVLEG 84

  Fly   102 --QAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTW 164
              |.:|..           .:.|.  |.:..:...|||.|::|::.......:.::.|.....:.
  Rat    85 GEQFIDAE-----------KIIRH--PEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCAST 136

  Fly   165 SSNILKNLVKFNTTGWGRTES----------RINSPVLQQASLTHHHLSYCAQVFGKQLDKSHIC 219
            .:..|       .:|||.|.|          .:.:|||..:|        |.:.:..|:..:..|
  Rat   137 DAQCL-------VSGWGNTVSIGGKYPALLQCLEAPVLSASS--------CKKSYPGQITSNMFC 186

  Fly   220 VASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF--GPTVYTNVIHFANWIE 278
            :....|  .:|.||||||:.....|.        |:||:|:|...  .|.|||.|.::.:||:
  Rat   187 LGFLEGGKDSCDGDSGGPVVCNGEIQ--------GIVSWGSVCAMRGKPGVYTKVCNYLSWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 63/255 (25%)
Tryp_SPc 42..280 CDD:238113 65/257 (25%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 63/255 (25%)
Tryp_SPc 24..243 CDD:238113 65/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.