DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and TMPRSS12

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_872365.2 Gene:TMPRSS12 / 283471 HGNCID:28779 Length:348 Species:Homo sapiens


Alignment Length:281 Identity:87/281 - (30%)
Similarity:131/281 - (46%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QGQPHLLDPQCVTARSEPGLY--RVINGKPADLFSNPWMVII-IERGMM---KCGGSLITPRYVL 78
            :|..|..|  |.||..:..|.  |:|.|..|...:.||:|.: |:.|.:   .|||:|:..|:||
Human    56 EGGAHAED--CGTAPLKDVLQGSRIIGGTEAQAGAWPWVVSLQIKYGRVLVHVCGGTLVRERWVL 118

  Fly    79 TAAHCKSETKSQL--TVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALL 140
            |||||..:....|  |..:|..::        :|..|..::|.:....: |:.......|||||.
Human   119 TAAHCTKDASDPLMWTAVIGTNNI--------HGRYPHTKKIKIKAIIIHPNFILESYVNDIALF 175

  Fly   141 RLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQASLTHHHLS- 203
            .|:..|:|.|.|:.|||....:    .||....|...:|||||:...|:. :||.|.:  |::| 
Human   176 HLKKAVRYNDYIQPICLPFDVF----QILDGNTKCFISGWGRTKEEGNATNILQDAEV--HYISR 234

  Fly   204 -YC--AQVFGKQLDKSHICVASSTGS--TCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG 263
             .|  .:.:|..:..:..|.....|:  ||:|||||||..  .:...:|..:.|:.|||  |..|
Human   235 EMCNSERSYGGIIPNTSFCAGDEDGAFDTCRGDSGGPLMC--YLPEYKRFFVMGITSYG--HGCG 295

  Fly   264 ----PTVYTNVIHFANWIELH 280
                |.||.....:..|:..|
Human   296 RRGFPGVYIGPSFYQKWLTEH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/253 (31%)
Tryp_SPc 42..280 CDD:238113 78/255 (31%)
TMPRSS12NP_872365.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 2/6 (33%)
Tryp_SPc 78..316 CDD:238113 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7507
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.