DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG18636

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:279 Identity:96/279 - (34%)
Similarity:141/279 - (50%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII-IERGMMKCGG 69
            |.::|:..|:.   .|....|||.|.........||:|||..|...|:||||.: ....|..|||
  Fly    12 VGIILMFQLLH---SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73

  Fly    70 SLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVT------RTYVPSH 128
            ||||.:.||||||| ......|..|||:|:..::.:|:.|.|  ..||.::.      :.|.|  
  Fly    74 SLITDKLVLTAAHC-FIANQHLVARLGEYERTRSEECTGYYC--NFREEHMVDAGFKHKLYDP-- 133

  Fly   129 YTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQ 193
              |...||||:|||..:|.|.||||.||::. |:.| .:.|..:.....||||:|:...:|..||
  Fly   134 --NTHANDIAILRLSKSVVYRDNIRPICVVW-DHRW-RHYLDKIDLLTATGWGKTQMESDSDALQ 194

  Fly   194 QASLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGA 258
            ...:.......||:..|:.:..:..|..:...:.|.|||||||.|.:...:.:|.:..|:.||..
  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259

  Fly   259 VHCFGPTVYTNVIHFANWI 277
            .:|...:|:|:|:..|.:|
  Fly   260 RNCQKASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 86/242 (36%)
Tryp_SPc 42..280 CDD:238113 86/243 (35%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 86/242 (36%)
Tryp_SPc 45..278 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.