DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG33225

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:279 Identity:100/279 - (35%)
Similarity:145/279 - (51%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSL 71
            :::||.:||.....|...||...|.|.|....:.||:.|..||.|:|||||:::....:.|.|||
  Fly    22 EIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSL 86

  Fly    72 ITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY--TNFRK 134
            ||..:|||:|.|......|  |.||:||.|    |:|..|....:.|::.:..:...:  ...:|
  Fly    87 ITRLFVLTSASCLLSLPKQ--VILGEYDRN----CTSADCTSIRQVIDIDQKIIHGQFGLETVKK 145

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            .|||||||...|...|.:|.|||.:     ...:.:::..|..||||.||....|.:||..:|:.
  Fly   146 YDIALLRLAKKVSISDYVRPICLSV-----DRQVGRSVQHFTATGWGTTEWNEPSTILQTVTLSK 205

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRI------GSERRVILFGVVSYGA 258
            .:..||.....:.:|.|.:||......||.||:||||:..::|      .::.|..|.|:||||:
  Fly   206 INRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGS 270

  Fly   259 VHCFGPTVYTNVIHFANWI 277
            ..|.|..|||||.|:.:||
  Fly   271 SSCSGIGVYTNVEHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 88/243 (36%)
Tryp_SPc 42..280 CDD:238113 89/244 (36%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 88/243 (36%)
Tryp_SPc 57..292 CDD:238113 89/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472846
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.