DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG33226

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:275 Identity:116/275 - (42%)
Similarity:163/275 - (59%) Gaps:18/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALVFLKVQGQPHLLDPQCVTARSEPGL-YRVINGKPADLFSNPWMVIIIERGMMKCGGSLITP 74
            ::||...:..|| .||||.||  ::..|: .:::.|..||:..:||||.|::||...||||||:.
  Fly    18 ILALRSYESLGQ-DLLDPNCV--QTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISS 79

  Fly    75 RYVLTAAHCKSETKSQLTVRLGDYD-VNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIA 138
            .:|||||||.|  :.:|.||.|.|. :.....|||..|.|...||:|.|.::.|.|.::...|||
  Fly    80 LFVLTAAHCHS--RYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIA 142

  Fly   139 LLRLETTVQYGDNIRSICLLMGDYTWSSN------ILKNLVKFNTTGWGRTESRINSPVLQQASL 197
            |..|...|:|....|.||:|.     :||      .|..:..||.||||:|||::.|.:||..||
  Fly   143 LFLLAKPVRYNVQTRPICVLQ-----TSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSL 202

  Fly   198 THHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF 262
            .|....:|||:|.:::...|||...|..|||.|||||||:|.:.....:|.:|||::||||.:|.
  Fly   203 FHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCR 267

  Fly   263 GPTVYTNVIHFANWI 277
            ..||:|||:.::|||
  Fly   268 EVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 103/242 (43%)
Tryp_SPc 42..280 CDD:238113 105/243 (43%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 105/243 (43%)
Tryp_SPc 47..282 CDD:214473 103/241 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472836
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.