DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG33461

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:289 Identity:93/289 - (32%)
Similarity:141/289 - (48%) Gaps:36/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHL-LDPQCVTARSEPGL-YRVINGKPADLFSNPWMVIIIERGMMKCGGS 70
            ::..:||..|.|.|...: |:..|...   |.| |::|||.||.|...|||..:.......|.||
  Fly     9 IIAYLALFVLGVHGSSSVFLEENCGVV---PRLSYKIINGTPARLGRYPWMAFLHTPTYFLCAGS 70

  Fly    71 LITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVT-----RTYVPSHYT 130
            ||...:|||:||| .|...:|..|||:.:.:..:||.:..|:...:|.||.     |.|.|..::
  Fly    71 LINQWFVLTSAHC-IEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFS 134

  Fly   131 NFRKNDIALLRLETTVQYGDNIRSIC--------LLMGDYTWSSNILKNLVKFNTTGWGRTESRI 187
                |||.:||||..|:|..:|:.||        |::...||          |..||||.|.:.:
  Fly   135 ----NDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITW----------FKATGWGLTSTDL 185

  Fly   188 N---SPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVI 249
            |   |.||.:.:|.....:.||::|.:......||..:..|:.|:||||||....|.|...:|.:
  Fly   186 NTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFV 250

  Fly   250 LFGVVSYGAVHCFGPTVYTNVIHFANWIE 278
            ..|:.|:...:|...::.|:|:.:..||:
  Fly   251 QMGIASFTYENCSKVSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 81/251 (32%)
Tryp_SPc 42..280 CDD:238113 83/253 (33%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 81/251 (32%)
Tryp_SPc 42..281 CDD:238113 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.