DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Gzma

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:288 Identity:79/288 - (27%)
Similarity:120/288 - (41%) Gaps:57/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPR 75
            |..::||       ||.|       |.|..|:|.|......|.|:||::..:....|.|:||...
  Rat    12 LTTVIFL-------LLIP-------EGGCERIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKN 62

  Fly    76 YVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTY-VPSHYTNFRKNDIAL 139
            :|||||||....||:  |.||.:.:.:.         |..:.::|.:.| .|....:..:.|:.|
  Rat    63 WVLTAAHCIPGKKSE--VILGAHSIKKE---------PEQQILSVKKAYPYPCFDKHTHEGDLQL 116

  Fly   140 LRLETTVQYGDNIRSICL-LMGDYTWSSNILKNLVKFNTTGWGRTESRINSP---VLQQASLTHH 200
            |||:.......|:..:.| ..||      .:|...:.:..||||..::  ||   .|::.::|..
  Rat   117 LRLKKKATLNKNVAILHLPKKGD------DVKPGTRCHVAGWGRFHNK--SPPSDTLREVNITVI 173

  Fly   201 HLSYCAQV----FGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAV 259
            ....|...    |...:..:.||..:..|  .:|.|||||||...   |..|.:..||:..    
  Rat   174 DRKICNDEKHYNFNPVIGLNMICAGNLRGGKDSCYGDSGGPLLCE---GIFRGITAFGLEG---- 231

  Fly   260 HC---FGPTVYTNVI--HFANWIELHTK 282
            .|   .||.:||.:.  |. :||....|
  Rat   232 RCGDPKGPGIYTLLSDKHL-DWIRKTAK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/251 (27%)
Tryp_SPc 42..280 CDD:238113 69/253 (27%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 68/251 (27%)
Tryp_SPc 29..256 CDD:238113 69/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.