DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss45

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:312 Identity:81/312 - (25%)
Similarity:128/312 - (41%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAGAVQLLLLIAL-VFLKVQGQPHL------LDPQCVTARSEPGLYRVINGKPADLFSN---PWM 56
            |.|:::..:||.. ..|.:..:|:|      .:|.|.|.           ..|.:|..:   ||.
Mouse    11 GPGSLRRWILICFAALLLLPPRPNLGYNENYTEPVCGTP-----------WWPDNLEESHHWPWE 64

  Fly    57 VIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVT 121
            ..:.......|||:||...:|::||||....| :.:|.||...::.  :.||:     ..:|.|.
Mouse    65 ASLQIEDKHVCGGALIDRSWVVSAAHCIQGNK-EYSVMLGSSTLHP--NGSSW-----TLKIPVG 121

  Fly   122 RTYVPSHY--TNFRKNDIALLRLETTVQYGDNIRSICL-------LMGDYTWSSNILKNLVKFNT 177
            ...:...|  .||.::|||||.|||.|.:...::.|||       .:|...|            .
Mouse   122 DIIIHPKYWGRNFIRSDIALLCLETPVTFNKYVQPICLPEHNFNFKVGTKCW------------V 174

  Fly   178 TGWGRTESRIN-----SPVLQQASLTHHHLSYCAQVFGKQ---------LDKSHICVASSTGSTC 228
            ||||:.:...:     :|.|.:|.:.......|..:|.|:         :.|:.||..:.....|
Mouse   175 TGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYPQVVPLIRKNMICTTNYGEDLC 239

  Fly   229 QGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP--TVYTNVIHFANWIE 278
            .||.||||...:    :.|.||.||.|:.......|  :|||.:..:..||:
Mouse   240 YGDPGGPLACEI----DGRWILAGVFSWEKACATVPNLSVYTRITKYTIWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/263 (26%)
Tryp_SPc 42..280 CDD:238113 71/265 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 69/253 (27%)
Tryp_SPc 59..286 CDD:214473 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.