DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30289

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:275 Identity:105/275 - (38%)
Similarity:150/275 - (54%) Gaps:17/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALVFLKVQG---QPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSL 71
            ::.|||.|.:..   ...||...|..::.:|.:..:..|...::..|||||::  .....|||||
  Fly     7 VIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLV--WSSKPCGGSL 69

  Fly    72 ITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD-CSSYGCIPRPREINVTRTYVPSHYTNFR-K 134
            |..::|||||||.|  ...|.||||||:....:. |.:..|||:...|:|....|..:|.... :
  Fly    70 IARQFVLTAAHCVS--FEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQ 132

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            |||||||:...|:|.|.:|.||||:|:.      ::::..|..||||.||....|.:|..|:|.:
  Fly   133 NDIALLRMSEAVEYSDYVRPICLLVGEQ------MQSIPMFTVTGWGETEYGQFSRILLNATLYN 191

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            ..:|||...|.||.|:|.||..|.|.:||:|||||||:::...|:......:|:||||:..|...
  Fly   192 MDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAAN 256

  Fly   265 T--VYTNVIHFANWI 277
            .  |||||.:...||
  Fly   257 VAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 95/239 (40%)
Tryp_SPc 42..280 CDD:238113 97/240 (40%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 95/238 (40%)
Tryp_SPc 42..271 CDD:238113 95/238 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472853
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.