DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30286

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:273 Identity:88/273 - (32%)
Similarity:146/273 - (53%) Gaps:11/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGK-PADLFSNPWMVIIIERGMMKCGGSL 71
            :|||.:|:..........|:|.|.....|    .:.|.: .|.:..:|||..:.:.|.:.|||:|
  Fly     4 ILLLTSLLPWHPHATAQFLEPDCGYMSPE----ALQNEEHQAHISESPWMAYLHKSGELVCGGTL 64

  Fly    72 ITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY--TNFRK 134
            :..|::||||||..|.:: ||||||:::...::||:...|:|...:..:...:....|  || |.
  Fly    65 VNHRFILTAAHCIREDEN-LTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTN-RI 127

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            :||.||||..:|:|..:|:.|||:..  |.....::.|.:...|||||:.|...:.:|:...:|.
  Fly   128 HDIGLLRLAKSVEYKVHIKPICLITN--TTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTR 190

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            .:...|::.:.....:..|||:..:|.:|.||||||:...:|:......:..|:||||...|..|
  Fly   191 VNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSP 255

  Fly   265 TVYTNVIHFANWI 277
            :|:|||:...:||
  Fly   256 SVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/238 (33%)
Tryp_SPc 42..280 CDD:238113 80/239 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 79/234 (34%)
Tryp_SPc 39..268 CDD:214473 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.