DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30187

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:277 Identity:92/277 - (33%)
Similarity:128/277 - (46%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLKVQGQPHLLDPQCVTARSEPGL---YRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYV 77
            |||..|....||..|       |:   .::..|..|...::.||..:..|....|||:||..|:|
  Fly    14 FLKDVGASIFLDQIC-------GINIALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFV 71

  Fly    78 LTAAHCKSETKSQLTVRLGDY---------DVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFR 133
            ||||||..:...| :|.||.|         ||..||..||:         :|..:|         
  Fly    72 LTAAHCIVDQDVQ-SVSLGAYNKSDPADRKDVITAVVHSSF---------DVRASY--------- 117

  Fly   134 KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLT 198
            :|||.||:|.:.|.:...||.||:::...  .:|.::|:..|...|||.......|.:||...|.
  Fly   118 ENDIGLLKLSSDVIFNALIRPICIVLNKS--MANHMRNMRTFKAFGWGTLRGNKTSDILQTIILN 180

  Fly   199 HHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRI-GSERRVILFGVVSYGAVHCF 262
            |.....|.........:..||....:|.||.||||||||..|.| |...|.:.||::|.|...|.
  Fly   181 HLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCD 245

  Fly   263 GPTVYTNVIHFANWIEL 279
            |..|||:::.||:||::
  Fly   246 GQGVYTDLMSFADWIKM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 82/245 (33%)
Tryp_SPc 42..280 CDD:238113 84/248 (34%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 82/245 (33%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.