DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30091

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:281 Identity:93/281 - (33%)
Similarity:134/281 - (47%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVFLKVQGQPHLLDPQC-VTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            ::|.|.:....:|...|||..| |..:..|   :::.|..|....||||.:|.......||||:|
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIP---KIVGGVDAGELKNPWMALIKTNDEFICGGSVI 67

  Fly    73 TPRYVLTAAHCKSETK------SQLTVRLGDYDVNQAVDCSSYGCIPRPREI-NVTRTYVPSHYT 130
            |.::|||||||....:      :||||.||.|.:      .:.|....|.|| ||.|.|:...:.
  Fly    68 TNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHL------LATGEHNHPHEIYNVERVYIHDSFA 126

  Fly   131 --NFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQ 193
              |:| ||||||||:.::.|...|:.:|:|:.|.......|  :.:|...|||.|.:...|..||
  Fly   127 IQNYR-NDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDL--IQEFTAIGWGVTGNGKMSNNLQ 188

  Fly   194 QASLTHHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYG 257
            ...:.......|...|....|....|..::.| .||:.||||||...:.....:|....|:||.|
  Fly   189 MVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTG 253

  Fly   258 AVHCFGPTVYTNVIHFANWIE 278
            ...|.|..:||:|:...::||
  Fly   254 TEDCRGFGMYTDVMGHIDFIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 82/245 (33%)
Tryp_SPc 42..280 CDD:238113 84/247 (34%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 82/245 (33%)
Tryp_SPc 37..276 CDD:238113 84/247 (34%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.