DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30087

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:94/271 - (34%)
Similarity:141/271 - (52%) Gaps:13/271 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALVFLKVQG--QPHLLDPQC-VTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            :||:..::.|.  ....|:|.| ||..|:..: ||:|||.|.:.|.|:||.:....:..||||::
  Fly     9 VIAICLIRQQRIVDAQFLNPLCGVTYESQTAM-RVVNGKEAVIRSAPFMVYVTNNSLTHCGGSIL 72

  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK-ND 136
            ..||:||||||   ....|.:|||::::....||....|.||..|..:.:......|..... ||
  Fly    73 NSRYILTAAHC---VFPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVND 134

  Fly   137 IALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHH 201
            ||||:|..::.:..:|:.||:|:...:..|     :..:.|.|||.|:......:||.|.|..:.
  Fly   135 IALLKLNRSINFNVHIQPICILLNPASAPS-----VATYQTFGWGETKKNGFPHLLQTAELRAYD 194

  Fly   202 LSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPTV 266
            .:||::.|...::.:.||.......||.|||||||..||.....:|.:..|:||||...|..|.|
  Fly   195 AAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQSPGV 259

  Fly   267 YTNVIHFANWI 277
            ||.|.::.|||
  Fly   260 YTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 83/236 (35%)
Tryp_SPc 42..280 CDD:238113 84/237 (35%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 83/236 (35%)
Tryp_SPc 42..272 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.