DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30083

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:276 Identity:82/276 - (29%)
Similarity:131/276 - (47%) Gaps:29/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII-----ERGMMKC 67
            :..:..::.|........|:|.|......|   ::::|:.|:..:||||..|.     |...:.|
  Fly     3 IFTIFKIILLWPGAMSQFLEPNCGYPDISP---KIMHGQNAENGTNPWMAYIFKYNDKEVAELVC 64

  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY-TN 131
            ||:||..::||:||||....:. |.||||::..:              |...||:.:...:: |.
  Fly    65 GGTLIHKQFVLSAAHCIKRDQI-LAVRLGEHSSS--------------RYFAVTKAFRNKYFTTG 114

  Fly   132 FRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQAS 196
            ...|||.:||::..|::...||.||::.     ....:.|:..|...|||:||:...|.||:...
  Fly   115 SYSNDIGILRIQPIVKFNAVIRPICIIT-----DPTKVPNVKTFKAAGWGKTENETFSKVLKTVE 174

  Fly   197 LTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC 261
            |...:.|.|..:....:.:|.||.....|.||.|||||||...|.:....|.:..|::|:|:..|
  Fly   175 LNELNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC 239

  Fly   262 FGPTVYTNVIHFANWI 277
            ..|.|||.:..|.:||
  Fly   240 NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/241 (31%)
Tryp_SPc 42..280 CDD:238113 77/242 (32%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 75/241 (31%)
Tryp_SPc 34..255 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.