DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30031

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:292 Identity:85/292 - (29%)
Similarity:131/292 - (44%) Gaps:64/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQ-PHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGG 69
            ::.::|::.|...:.|. |..|.||.      .|  |::.|....:.|.||.:.:...|...|||
  Fly     2 LKFVILLSAVACALGGTVPEGLLPQL------DG--RIVGGSATTISSFPWQISLQRSGSHSCGG 58

  Fly    70 SLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAVDCSSY---GCIPRPREINVTRTYVPSHYT 130
            |:.:...::||||| :|.:.|.|.:|.|          |||   |.:          |:..|.:.
  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAG----------SSYWSSGGV----------TFSVSSFK 103

  Fly   131 NFR-------KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRIN 188
            |..       .||||::::...:.:...|::|.|.      ||| ..|....:.:||| |.|..:
  Fly   104 NHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLA------SSN-PANGAAASVSGWG-TLSYGS 160

  Fly   189 SPV---LQQASLTHHHLSYCAQV---FGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERR 247
            |.:   ||..::.....|.||..   :|.|:..:.||.|:|....|||||||||.:    |.   
  Fly   161 SSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVS----GG--- 218

  Fly   248 VILFGVVS--YGAVHCFGPTVYTNVIHFANWI 277
             :|.||||  ||..:...|.||.:|....:|:
  Fly   219 -VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/254 (30%)
Tryp_SPc 42..280 CDD:238113 76/255 (30%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.