DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30002

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:257 Identity:83/257 - (32%)
Similarity:124/257 - (48%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YRVINGKPADLFSNPWMV---IIIERGMMKCGGSLITPRYVLTAAHC--KSETKSQLTVRLGDYD 99
            :.:..|:.:.|.|.|||.   |..:..|.:||||||:..:|||||||  ......::.|.||:.|
  Fly    60 FMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELD 124

  Fly   100 VNQAVDCSSYG----CIPRPREINVTRTYVPSHYTNFRKN-DIALLRLETTVQYGDNIRSICLLM 159
            ::...||::|.    |.|...|..:.:..:...:..|... ||||::|...|.:.|:||.|||.:
  Fly   125 LSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPL 189

  Fly   160 GD----YTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHH---HLSYCAQVFGKQLDKSH 217
            .|    :|     |:...:|...|||:|||      |:.|:.|..   ....|..  |:  |.|.
  Fly   190 TDELLAFT-----LQLGQRFMAVGWGKTES------LRYANSTMEVDIRTEKCTD--GR--DTSF 239

  Fly   218 ICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVIHFANWI 277
            :|.:.....||.|||||||..:..:..:.|.:.|||||.|:.:|..  ...|.:|..:..||
  Fly   240 LCASGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 81/254 (32%)
Tryp_SPc 42..280 CDD:238113 83/255 (33%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 81/253 (32%)
Tryp_SPc 62..301 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.