DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Klk1b3

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:297 Identity:78/297 - (26%)
Similarity:118/297 - (39%) Gaps:60/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            |:|.:||...:....|             |...||:.|...::.|.||.|.:...|...|||.||
  Rat     8 LILFLALSLGRNDAAP-------------PVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLI 59

  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGDYD---------VNQAVDCSSYGCIPRP---REINVTRTYV 125
            .|.:|:|||||.::.......|...|:         |:|:        .|.|   :::....|..
  Rat    60 DPSWVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQS--------FPHPGFNQDLIWNHTRQ 116

  Fly   126 P-SHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGR-TESRIN 188
            | ..|:    ||:.||.|.......|.::.|.|.:.:....|..|       .:|||. |...:.
  Rat   117 PGDDYS----NDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCL-------ASGWGSITPDGLE 170

  Fly   189 -SPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVIL 250
             |..||..::.......|.:...:::....:|.....|  .||:|||||||..        ..:|
  Rat   171 LSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLIC--------NGVL 227

  Fly   251 FGVVSYGAVHCFGPT---VYTNVIHFANWIELHTKKN 284
            .|:.|:|...|..|.   :||.:|.|..||:...|:|
  Rat   228 QGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKEN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/255 (27%)
Tryp_SPc 42..280 CDD:238113 69/257 (27%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 68/255 (27%)
Tryp_SPc 29..260 CDD:238113 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.