DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Mst1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:272 Identity:76/272 - (27%)
Similarity:115/272 - (42%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHLLDP-------QCVTARSEPGLYRVINGKPADLFSNPWMVIIIER-GMMKCGGSLITPRYVLT 79
            |.:|||       :|.....:....||:.|.|.   ::||.|.:..| |...|||||:..::|||
  Rat   494 PSILDPPVQVQFEKCGKRVDQSNRLRVVGGHPG---NSPWTVSLRNRQGQHFCGGSLVKEQWVLT 555

  Fly    80 AAHCKSETKSQLT---VRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLR 141
            |..|.......||   |.||..:.|           |:|.|.|:.|..|.........:.:.||:
  Rat   556 ARQCIWSCHDPLTGYEVWLGTINQN-----------PQPGEANLQRVSVAKTVCGPAGSQLVLLK 609

  Fly   142 LETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCA 206
            ||..|....::..|||....|     ::.........|||.::...||.||..|.:.......|.
  Rat   610 LERPVILNHHVARICLPPEQY-----VVPPGTNCEIAGWGESKGTSNSTVLHVAKMKVISSQECN 669

  Fly   207 QVFGKQLDKSHIC---VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF---GPT 265
            ..:.:::.:|.||   :.:.||: |:||.||||...    :....:|.|::....| |.   .|.
  Rat   670 VKYRRRVQESEICTEGLLAPTGA-CEGDYGGPLACY----THDCWVLQGLIIPNRV-CARPRWPA 728

  Fly   266 VYTNVIHFANWI 277
            ::|.|..|.:||
  Rat   729 IFTRVSVFVDWI 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/245 (28%)
Tryp_SPc 42..280 CDD:238113 70/246 (28%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527
Tryp_SPc 520..743 CDD:238113 70/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.