DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:113/269 - (42%) Gaps:82/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVN---- 101
            :::.|......|.|:.| .:..|...||||||..::|::||||   .|.::.||||::::|    
Mouse    23 KIVGGYTCRESSVPYQV-SLNAGYHFCGGSLINDQWVVSAAHC---YKYRIQVRLGEHNINVLEG 83

  Fly   102 --QAVDCSSYGCIPRPREINVTRTYVPSHYTNFR-KNDIALLRLETTVQYGDNIRSI-------- 155
              |.||  |...|..|            :|.::. .|||.|::|.:.|.....:.|:        
Mouse    84 NEQFVD--SAKIIRHP------------NYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAP 134

  Fly   156 ----CLLMGDYTWSSNILKNLVKFNTTGWGRTESR----------INSPVLQQASLTHHHLSYCA 206
                ||:                   :|||.|.|.          :::|||.||.        |.
Mouse   135 AGTQCLI-------------------SGWGNTLSNGVNNPDLLQCVDAPVLPQAD--------CE 172

  Fly   207 QVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPTVYTN 269
            ..:...:..:.|||....|  .:||||||||:...   |..:.::.:|   ||......|.|||.
Mouse   173 ASYPGDITNNMICVGFLEGGKDSCQGDSGGPVVCN---GELQGIVSWG---YGCAQPDAPGVYTK 231

  Fly   270 VIHFANWIE 278
            |.::.:||:
Mouse   232 VCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/266 (26%)
Tryp_SPc 42..280 CDD:238113 72/268 (27%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 70/266 (26%)
Tryp_SPc 24..242 CDD:238113 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.