DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss47

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006517555.1 Gene:Prss47 / 218304 MGIID:2685120 Length:370 Species:Mus musculus


Alignment Length:333 Identity:87/333 - (26%)
Similarity:137/333 - (41%) Gaps:78/333 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALV-----FLKVQG-QPHLLDPQ----CVTARSEPGLYRVINGKP---ADLFSN------ 53
            ||||:.:.     ..||.| .|....||    ...:|::..:.|.:.|||   ..:|..      
Mouse    19 LLLLLPIKPSIPNASKVSGIAPGRPQPQQGWEPSASRNQYPVNRPVCGKPKMVGKVFGGQDTLAG 83

  Fly    54 --PWMVIIIERGMMKCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQAVDCSSYGCIP 113
              ||...::.||:..||..||...::.:.|||   ||:......|.||:..:.|..        .
Mouse    84 QWPWQASLLYRGVHLCGAVLIDTHWLASTAHCFRNKSQAPEDYEVLLGNNQLYQET--------K 140

  Fly   114 RPREINVTRTYVPSHYTNFRK-----NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLV 173
            ..::|:|  .::.|| .:|.|     :|||:|:|...:.:...:...||...|     ..|.|..
Mouse   141 HTQKISV--NHIVSH-PDFEKFHSFGSDIAMLQLHLPINFTSYVVPACLPSKD-----TQLSNHT 197

  Fly   174 KFNTTGWG--RTESRINSPV-LQQASLTHHHLSYCAQVFGKQLDKSH-------ICVAS-STG-S 226
            ....||||  ..::::..|. ||:..:......:|..::|:...:|.       :|... ||| |
Mouse   198 SCWITGWGMLSEDTKLLPPFSLQEGEVGIIDNEFCNALYGQTPGQSRNYVYEEMLCAGGLSTGKS 262

  Fly   227 TCQGDSGGPLTARVRIGSERRVILFGVVSYG--AVHCFGPTVYTNVIHFANWI------------ 277
            .|:|||||||...    .....:|.|:.|:|  ..|...|:|:|.|.:|.:||            
Mouse   263 ICRGDSGGPLICY----HNSTWVLVGLASWGLDCRHPIYPSVFTRVAYFTDWISQVKRLTPLPEP 323

  Fly   278 ---ELHTK 282
               .|||:
Mouse   324 VSVSLHTE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/268 (26%)
Tryp_SPc 42..280 CDD:238113 72/285 (25%)
Prss47XP_006517555.1 Tryp_SPc 74..314 CDD:238113 69/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.