DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss40

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_033382.2 Gene:Prss40 / 21756 MGIID:1270857 Length:365 Species:Mus musculus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:128/329 - (38%) Gaps:74/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAGAVQLLLLIALVFLKVQGQPHL-----------------LDPQCVTARSEPGLYRVINGKPAD 49
            |||.:..||.::.:....|...|:                 |...|...:.:..:|   .|:.|.
Mouse    15 GAGLLAALLGVSFLSQHAQTAEHVTNAANNTTIQIMKSTLSLSEVCGKTKFQGKIY---GGQIAG 76

  Fly    50 LFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC--KSETKSQLTVRLGDYDVNQAVDCSSYGCI 112
            ....||...:...|...||..||...:||:||||  :|:..|...|.||..|:|.....|     
Mouse    77 AERWPWQASLRLYGRHICGAVLIDKNWVLSAAHCFQRSQEPSDYHVMLGYTDLNSPTRYS----- 136

  Fly   113 PRPREINVTRTYVPSHYTNF--RKNDIALLRLETTVQYGDNIRSICLLMGDY-------TWSSNI 168
               |.::|.:..|...|..|  :.:||.||:|.::|:|..:|...|:...:.       .|:|  
Mouse   137 ---RTMSVQKVIVHKDYNRFHTQGSDIVLLQLRSSVEYSSHILPACVPEENIKIPKEKACWAS-- 196

  Fly   169 LKNLVKFNTTGWG--RTESRINSP-VLQQASLTHHHLSYCAQVFGKQLDKS---------HICVA 221
                      |||  |.:.||..| .|.:|.|.......|...|...:..|         .:|.|
Mouse   197 ----------GWGYLREDVRIPLPNELYEAELIIMSNDQCKGFFPPPVPGSGRSYYIYDDMVCAA 251

  Fly   222 --SSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC----FGPTVYTNVIHFANWIELH 280
              ..:.|.|.|||||||...:    |....:.|:.|:.:. |    ..|:|:..|.:|..||:.:
Mouse   252 DYDMSKSICAGDSGGPLVCLL----EGSWYVVGLTSWSST-CEEPIVSPSVFARVSYFDKWIKDN 311

  Fly   281 TKKN 284
            .|.:
Mouse   312 KKSS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/264 (27%)
Tryp_SPc 42..280 CDD:238113 73/266 (27%)
Prss40NP_033382.2 Tryp_SPc 68..308 CDD:214473 72/267 (27%)
Tryp_SPc 69..311 CDD:238113 74/269 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..343 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.