powered by:
Protein Alignment CG30287 and Pik3ip1
DIOPT Version :9
Sequence 1: | NP_726083.1 |
Gene: | CG30287 / 246530 |
FlyBaseID: | FBgn0050287 |
Length: | 284 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_835362.2 |
Gene: | Pik3ip1 / 216505 |
MGIID: | 1917016 |
Length: | 264 |
Species: | Mus musculus |
Alignment Length: | 55 |
Identity: | 15/55 - (27%) |
Similarity: | 20/55 - (36%) |
Gaps: | 9/55 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 LIALVFLKVQG-QPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGM 64
|..|.:|..|| :..|.:| .||.:........|. ..||..|..|.|:
Mouse 44 LRCLNWLAAQGSRESLTEP-------SPGNHNYCRNPDQDP-RGPWCYISSETGV 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167833209 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.