DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Hgf

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:269 Identity:74/269 - (27%)
Similarity:113/269 - (42%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC---KSETKSQLTVRLGDYDVNQ 102
            ||:||.|... :..|||.:..|....||||||...:||||..|   :::........||.:||::
Mouse   495 RVVNGIPTQT-TVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHE 558

  Fly   103 AVDCSSYGCIPRPREINVTR-TYVPSHYTNFRKNDIALLRLE---------TTV---QYGDNI-- 152
            .      |...|.:.:|::: .|.|      ..:|:.||:|.         :|:   .||..|  
Mouse   559 R------GEEKRKQILNISQLVYGP------EGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPE 611

  Fly   153 RSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQASL--------THHHLSYCAQV 208
            ::.|.:.                   |||.| ..||:. :|:.|.|        :.||.      
Mouse   612 KTTCSIY-------------------GWGYT-GLINADGLLRVAHLYIMGNEKCSQHHQ------ 650

  Fly   209 FGK-QLDKSHICV-ASSTGS-TCQGDSGGPLTARVRIGSERRVILFGVV--SYGAVHCFGPTVYT 268
             || .|::|.:|. |...|| .|:||.||||.....   :.|::| ||:  ..|......|.::.
Mouse   651 -GKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQH---KMRMVL-GVIVPGRGCAIPNRPGIFV 710

  Fly   269 NVIHFANWI 277
            .|.::|.||
Mouse   711 RVAYYAKWI 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/267 (27%)
Tryp_SPc 42..280 CDD:238113 73/268 (27%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 72/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.