DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Gzmk

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:273 Identity:74/273 - (27%)
Similarity:116/273 - (42%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GLY--------RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKS--ETKSQLT 92
            |:|        .:|.|:.....|.|:|..|..|....|||.||.|::|||||||.|  ......|
Mouse    14 GVYMSSECFHTEIIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPT 78

  Fly    93 VRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVP---------SHYTNFRKNDIALLRLETTVQY 148
            |.||.:.:::..        |..:...: :.::|         ||       ||.|::|.|..:.
Mouse    79 VVLGAHSLSKNE--------PMKQTFEI-KKFIPFSRLQSGSASH-------DIMLIKLRTAAEL 127

  Fly   149 GDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRI--NSPVLQQASLTHHHLSYC-AQVFG 210
            ..|::.:      :..|.|.|::..|...||||.|:..:  .|..|::.::|......| :|.:.
Mouse   128 NKNVQLL------HLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYY 186

  Fly   211 KQ---LDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTV 266
            ..   :.|..||...:.|  .:|:|||||||..        :.|...:||.| ..| |    |.:
Mouse   187 NHKPVITKDMICAGDARGQKDSCKGDSGGPLIC--------KGIFHALVSQG-YKC-GIAKKPGI 241

  Fly   267 YTNVI-HFANWIE 278
            ||.:. .:..||:
Mouse   242 YTLLTKKYQTWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/259 (27%)
Tryp_SPc 42..280 CDD:238113 72/261 (28%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 70/259 (27%)
Tryp_SPc 26..256 CDD:238113 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.