DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Gzma

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:289 Identity:77/289 - (26%)
Similarity:114/289 - (39%) Gaps:68/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPR 75
            |..|:||       ||.|       |.|..|:|.|......|.|:|.::.......|.|:||...
Mouse    12 LATLLFL-------LLIP-------EGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKN 62

  Fly    76 YVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF-RKNDIAL 139
            :|||||||....:|:..  ||.:.:|:.         |..:.:.|.:.:....|..: |:.|:.|
Mouse    63 WVLTAAHCNVGKRSKFI--LGAHSINKE---------PEQQILTVKKAFPYPCYDEYTREGDLQL 116

  Fly   140 LRLETTVQYGDNIRSICL-LMGDYTWSSNILKNLVKFNTTGWGRTESR-INSPVLQQASLTHHHL 202
            :||:.......|:..:.| ..||      .:|...:....||||..:: ..|..|::.::|....
Mouse   117 VRLKKKATVNRNVAILHLPKKGD------DVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDR 175

  Fly   203 SYCAQVFGKQLDKSH-----------ICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVV 254
            ..|.       |:.|           ||.....|  .:|.||||.||..        ..||.|:.
Mouse   176 KICN-------DEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLC--------DGILRGIT 225

  Fly   255 SYGAVHCFG---PTVYTNVI--HFANWIE 278
            |:|...|..   |.|||.:.  |. |||:
Mouse   226 SFGGEKCGDRRWPGVYTFLSDKHL-NWIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 66/256 (26%)
Tryp_SPc 42..280 CDD:238113 67/258 (26%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 66/256 (26%)
Tryp_SPc 29..255 CDD:238113 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.