DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Klk1b9

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:296 Identity:79/296 - (26%)
Similarity:117/296 - (39%) Gaps:58/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            |:|.:||....:...|             |...|::.|...:..|.||.|.:.......|||.|:
Mouse     4 LILFLALSLGGIDAAP-------------PVHSRIVGGFKCEKNSQPWHVAVYRYNEYICGGVLL 55

  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV-PS-----HYTN 131
            ...:|||||||..|...   |.||..::        |...|..:...|::::: |.     |..:
Mouse    56 DANWVLTAAHCYYEENK---VSLGKNNL--------YEEEPSAQHRLVSKSFLHPGYNRSLHRNH 109

  Fly   132 FR------KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTE--SRIN 188
            .|      .||:.||||.......|.::.|.|...:....|..|       .:|||.|.  ...|
Mouse   110 IRHPEYDYSNDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCL-------ASGWGSTTPFKFQN 167

  Fly   189 SPVLQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILF 251
            :..||..:|.......|.:...:::....:|...:.|  .||:|||||||..        ..:|.
Mouse   168 AKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKDTCKGDSGGPLIC--------DGVLQ 224

  Fly   252 GVVSYGAVHCFGPT---VYTNVIHFANWIELHTKKN 284
            |:.|:|...|..|.   |||.:|.|.:||:....||
Mouse   225 GITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMAKN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/254 (27%)
Tryp_SPc 42..280 CDD:238113 70/256 (27%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 69/254 (27%)
Tryp_SPc 25..256 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.