DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Ctsg

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_031826.1 Gene:Ctsg / 13035 MGIID:88563 Length:261 Species:Mus musculus


Alignment Length:282 Identity:79/282 - (28%)
Similarity:118/282 - (41%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII---ERGMMKCGGSL 71
            ||:.|.|:.:||             .|.|  ::|.|:.|...|.|:|..::   ..|:..|||.|
Mouse     4 LLLLLTFILLQG-------------DEAG--KIIGGREARPHSYPYMAFLLIQSPEGLSACGGFL 53

  Fly    72 ITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPRE---INVTRT-----YVPSH 128
            :...:|||||||..   |.:.|.||.:::..           |.|.   |.|.|.     |.|.:
Mouse    54 VREDFVLTAAHCLG---SSINVTLGAHNIQM-----------RERTQQLITVLRAIRHPDYNPQN 104

  Fly   129 YTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQ 193
            .    :|||.||:|....:...:::.:.|     ..:|..|:........||||......:.|||
Mouse   105 I----RNDIMLLQLRRRARRSGSVKPVAL-----PQASKKLQPGDLCTVAGWGRVSQSRGTNVLQ 160

  Fly   194 QASLTHHHLSYCAQVFGKQLDKSHICVAS--STGSTCQGDSGGPLTARVRIGSERRVILFGVVSY 256
            :..|.......||..|.....::.|||.:  ...|..:|||||||..        ..:..|:|||
Mouse   161 EVQLRVQMDQMCANRFQFYNSQTQICVGNPRERKSAFRGDSGGPLVC--------SNVAQGIVSY 217

  Fly   257 GAVHCFGPTVYTNVIHFANWIE 278
            |:.:...|.|:|.:..|..||:
Mouse   218 GSNNGNPPAVFTKIQSFMPWIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 69/248 (28%)
Tryp_SPc 42..280 CDD:238113 71/250 (28%)
CtsgNP_031826.1 Tryp_SPc 20..238 CDD:214473 69/248 (28%)
Tryp_SPc 21..241 CDD:238113 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.