DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:264 Identity:72/264 - (27%)
Similarity:118/264 - (44%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC------KSETKSQLTVRLG--- 96
            |::.|..::.....::..:.:||...||.|::..|::|||.||      |....:|:...||   
Mosquito    11 RIVGGVNSNRGQITYIASLTKRGGHFCGASIVNDRWLLTAGHCVCSGVNKILRANQIQAVLGLYR 75

  Fly    97 --DYDVNQAVDCSSYGCIPRPREINVTRTYV--PSHYTNFRKNDIALLRLETTVQYGDNIRSICL 157
              ::..|| :|...:.  .|..|:.: ||.|  |.:..|...||||||.|...:.:..::|.|||
Mosquito    76 RSEFGGNQ-IDSDPFS--DRAYEVGI-RTIVPHPGYVCNKPSNDIALLELARRIDFSASVRPICL 136

  Fly   158 LMGDYTWSSNILKNLVKFNTTGWGRTESRIN----SPVLQQASLTHHHLSYCAQVF-----GKQL 213
            ..| ...|:.:......  ..|||..:...|    :..||:|.:.......|..::     .:.:
Mosquito   137 SSG-ADGSARVEGQTAV--VAGWGWQQENRNLGDKADTLQRAVVDVFRNEECESMYRRGNRSRTI 198

  Fly   214 DKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHF 273
            .::.:|....||  ..|..||||||     :.|:.  :|.|:||.| :.|..   |.:||.|..:
Mosquito   199 ARTQLCAGKGTGGVDACWADSGGPL-----VTSDN--VLIGIVSTG-IGCARPGFPGIYTRVSEY 255

  Fly   274 ANWI 277
            |:||
Mosquito   256 ASWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/262 (27%)
Tryp_SPc 42..280 CDD:238113 71/263 (27%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 70/262 (27%)
Tryp_SPc 12..259 CDD:238113 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.