DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPB17

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_321448.4 Gene:CLIPB17 / 1281525 VectorBaseID:AGAP001648 Length:467 Species:Anopheles gambiae


Alignment Length:241 Identity:71/241 - (29%)
Similarity:111/241 - (46%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQA 103
            |.::.:|..|.....|||..::.:....|.|:||.|.|||||.||.:  ...:.||||.:|:.:.
Mosquito   229 LVKIQDGTYAQRGEFPWMANLVYKQKAICSGTLIHPSYVLTARHCIN--GGLVRVRLGKHDLLEK 291

  Fly   104 VDC---SSYGCIPRP----REINVTRTYVPSHYTNFRKNDIALLRLETTVQY-GDNIRSICLLMG 160
            .:|   ::.|.:..|    :||.:.:. :.||     .:|:.||||...... |:.:|.|||.: 
Mosquito   292 PECPPGTTAGGVDCPQLQVQEIAIAQK-MRSH-----THDVGLLRLAKPADVAGELVRPICLPV- 349

  Fly   161 DYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSY------CAQVFGKQLDKSHIC 219
               ::|..:........||||.||....:.||.:|     |.|.      ||:.:       .||
Mosquito   350 ---YASLRMYLPPSVTITGWGLTEKEKPATVLLKA-----HTSLLMDDPACAKDY-------MIC 399

  Fly   220 VASSTGST-CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            ...::.|. |.||||||..|......:.|.:.:|::|.|..:|..|
Mosquito   400 AGGTSHSNHCGGDSGGPYQALGVYDGKSRYVQYGIISDGPAYCSNP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/239 (29%)
Tryp_SPc 42..280 CDD:238113 70/238 (29%)
CLIPB17XP_321448.4 Tryp_SPc 235..461 CDD:214473 70/235 (30%)
Tryp_SPc 235..461 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.