DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:228 Identity:70/228 - (30%)
Similarity:102/228 - (44%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KCGGSLITPRYVLTAAHCKSETKSQLT---VRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPS 127
            |||||||...|:||||||.::..:.|:   :|:||.::..|.|..   .:...:.:.:.|.  |.
Mosquito    48 KCGGSLIWENYILTAAHCYADPDTILSPDVIRIGDLNLFDADDDE---FVQERKIVQIIRH--PL 107

  Fly   128 HYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNT---TGWGRTE-SRIN 188
            |..:....|:|||:|:..|...:.:...||      |    |.:.:.|:|   .|||:|. .:..
Mosquito   108 HNASTVYYDLALLKLDKKVIQSEGVIPTCL------W----LDDSIPFSTLEVAGWGQTGFGKEK 162

  Fly   189 SPVLQQASLTHHHLSYCAQV--------FGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSE 245
            |.:|.:|.|.....:.||:.        .|..|....:|.......||.|||||||...:.....
Mosquito   163 SNMLLKAELKLMTNTECAKYNNKRTQRRLGNDLADHQLCAWDEVMDTCPGDSGGPLHYNLYYKHT 227

  Fly   246 RRVILFGVVSYG-AVHCFGPTVYTNVIHFANWI 277
            :...|.||.|:| |.....|.||..|..|..||
Mosquito   228 KIPFLVGVTSFGKACAVSQPGVYVKVAKFKQWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/226 (30%)
Tryp_SPc 42..280 CDD:238113 70/228 (31%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 70/228 (31%)
Tryp_SPc 19..260 CDD:214473 68/226 (30%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.