DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP012022

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_320504.4 Gene:AgaP_AGAP012022 / 1280645 VectorBaseID:AGAP012022 Length:737 Species:Anopheles gambiae


Alignment Length:224 Identity:67/224 - (29%)
Similarity:102/224 - (45%) Gaps:27/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSLITPRYVLTAAHCKSETKS--QLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY 129
            ||||||...::||||||.::..:  ....|:||.::....|..   ...:.:.:.:.|.  |.|.
Mosquito    50 CGGSLIWENFILTAAHCAADDNNVPPDVARMGDINIYSDEDDE---FAQQLKIVEIIRH--PKHK 109

  Fly   130 TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRT---ESRINSPV 191
            .|....||||::||..|...:.:...||.:.|......:|       ..|||||   |....:.:
Mosquito   110 YNSNYYDIALMKLERNVTLHNTVAPTCLWLDDEIRFPELL-------AAGWGRTGFGEDTTKTLL 167

  Fly   192 -LQQASLTHHHLSYCAQVFGKQLDKS----HICVASSTGSTCQGDSGGPLTARVRIGSERRVI-- 249
             :|.|.:|:...|...|...::|:..    ..|.......||.|||||||  .|::..:.:::  
Mosquito   168 KVQLAPITNDKCSTHYQRGVRKLENGLMDHQFCAGDEKMDTCPGDSGGPL--HVKLFKKWKLVPF 230

  Fly   250 LFGVVSYG-AVHCFGPTVYTNVIHFANWI 277
            |.||.|:| |.....|.||..|..|::||
Mosquito   231 LVGVTSFGKACGISAPGVYVKVSKFSDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 65/222 (29%)
Tryp_SPc 42..280 CDD:238113 67/224 (30%)
AgaP_AGAP012022XP_320504.4 Tryp_SPc 23..262 CDD:238113 67/224 (30%)
Tryp_SPc 23..259 CDD:214473 65/222 (29%)
Tryp_SPc 335..533 CDD:304450
Tryp_SPc 648..>729 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.