DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP009273

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_320067.4 Gene:AgaP_AGAP009273 / 1280238 VectorBaseID:AGAP009273 Length:308 Species:Anopheles gambiae


Alignment Length:285 Identity:78/285 - (27%)
Similarity:124/285 - (43%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVI----IIERG------------MMKCGGSL 71
            |.|.|.||:          :..|...::...|.|.:    :.|.|            ..:|||||
Mosquito    47 PKLYDSQCL----------IFGGTQVNVTEFPHMAVLGWKVEELGEGADSGDDGAGVRWQCGGSL 101

  Fly    72 ITPRYVLTAAHCKSETKS--QLTVRLGDYDVNQAVDCSSYGCIPRPREINVTR-TYVPSHYTNFR 133
            ||.|:|||||||.::..:  ...|||||.::....| .:|.     ::.::.| ...|.|..:.:
Mosquito   102 ITLRFVLTAAHCAADANNIPPRLVRLGDVNLASTKD-DAYA-----QQFDILRIVRHPEHRFSRK 160

  Fly   134 KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGR-TESRINSPVLQQASL 197
            ..|:||:.|:..|:..:.:...||      |:::.:.....|.|.|:|. |....:.|.|.:.:|
Mosquito   161 YFDLALVELDGVVRLTEGVCPTCL------WTNSKVLPAQFFQTAGFGEITLGGGSVPTLLKTAL 219

  Fly   198 THHHLSYCAQVF--------GKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVV 254
            :....:.|::.|        |.:.|:  :|.:.....||||||||||...:|..|.....|..:.
Mosquito   220 SATDSTECSESFKYTRGLPEGIRHDQ--VCASMLNADTCQGDSGGPLQVSLRSYSTEHPFLVALT 282

  Fly   255 SYGAVHCFGPT-VYTNVIHFANWIE 278
            |:|.....|.: ||..|.....|||
Mosquito   283 SFGRGCGIGSSGVYQQVAAHIPWIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/264 (27%)
Tryp_SPc 42..280 CDD:238113 73/266 (27%)
AgaP_AGAP009273XP_320067.4 Tryp_SPc 56..308 CDD:238113 73/266 (27%)
Tryp_SPc 56..306 CDD:214473 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.