DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP009220

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_319997.4 Gene:AgaP_AGAP009220 / 1280178 VectorBaseID:AGAP009220 Length:325 Species:Anopheles gambiae


Alignment Length:261 Identity:91/261 - (34%)
Similarity:130/261 - (49%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GLY---RVINGKPADLFSNPWMVIIIER-GMMKCGGSLITPRYVLTAAHC--KSETKSQLTVRLG 96
            |.|   ::..|:.|.||..|||.::..: |...|||:||..|||||||||  .::..|   ||||
Mosquito    73 GAYTDDKISFGQDAKLFQFPWMALLKSKAGSFFCGGTLINERYVLTAAHCLVNNDVAS---VRLG 134

  Fly    97 DYDVNQAVDCSSYG-CIPRPREINVTRTYVPSHYT-NFRKNDIALLRLETTVQYGDNIRSICLLM 159
            :||:|..:||:.:| |.|.|::|.|.|......|: .::.:||.|:||.......||:..|||.:
Mosquito   135 EYDLNSTIDCNKHGDCAPAPQDIPVERAISHEDYSARYKLHDIGLIRLARRASLNDNVLPICLPV 199

  Fly   160 GDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQL---------DK 215
                 :...|.....|...|||:|::.:.:..||...|.......|.    |||         ..
Mosquito   200 -----TPAFLTKQTIFFVVGWGQTQNALFANKLQFTKLDLMANDECL----KQLRPKDRFVRISD 255

  Fly   216 SHIC-VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC---FGPTVYTNVIHFANW 276
            |.:| :.|:....|.|||||||.: :.| ...|.:.:||||:|...|   ..|.|||.|..:.:|
Mosquito   256 SQLCAIGSNLSDNCSGDSGGPLKS-ISI-QNSRYVQYGVVSFGLRTCGKQSAPGVYTRVERYVDW 318

  Fly   277 I 277
            |
Mosquito   319 I 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 87/253 (34%)
Tryp_SPc 42..280 CDD:238113 89/254 (35%)
AgaP_AGAP009220XP_319997.4 Tryp_SPc 83..319 CDD:214473 87/249 (35%)
Tryp_SPc 83..319 CDD:238113 87/249 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.